- TRMT12 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83633
- Human
- Unconjugated
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- TRMT12
- Rabbit
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: WFTQRYREYL QRQKLFDTQH RVEKMPDGSV ALPVLGETLP EQHLQELRNR VAPGSPCMLT QLPDPVPSKR AQGCSPAQKL CLEVSRWVE
- TRM12, TYW2
- tRNA methyltransferase 12 homolog
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cancer, Cell Cycle and Replication
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
WFTQRYREYLQRQKLFDTQHRVEKMPDGSVALPVLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQGCSPAQKLCLEVSRWVE
Specifications/Features
Available conjugates: Unconjugated